ll37 sequence linear in its amino acid sequence - LL-37 peptide buy LL-37 Unraveling the LL-37 Sequence: A Deep Dive into Human Antimicrobial Peptide

Ll37PDB The LL-37 sequence, a cornerstone of the human innate immune system, represents a fascinating area of scientific inquiry. This antimicrobial peptide LL-37 is not merely a static biological entity; its structure and function have been extensively studied, revealing intricate details about its role in defense and inflammationAnti-microbial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha- .... Derived from the human cationic antimicrobial protein 18 (hCAP18), specifically from amino acids aa 134-170 of the human cationic antimicrobial protein 18, LL-37 is a potent weapon against a broad spectrum of pathogens. Understanding the LL-37 sequence is crucial for appreciating its diverse biological activities and potential therapeutic applications.

At its core, LL-37 is a 37-amino acid peptide with the primary sequence [LL-37, 37 aa] This sequence, characterized by a pair of leucines (LL) at the N-terminus, dictates the peptide's amphipathic nature and its ability to interact with microbial membranes. These amino acids, represented by their one-letter codes as LEU}{LEU}{GLY}{ASP}{PHE}{PHE}{ARG}{LYS}{SER}{LYS}{GLU}{LYS}{ILE}{GLY}{LYS}{GLU}{PHE}, are fundamental to its function. The specific arrangement of these residues, forming a linear in its amino acid sequence structure without disulfide bonds, allows LL-37 to adopt helical conformations crucial for its antimicrobial activity. Scientific databases like PubChem (CID 16198951) meticulously document this structure and its associated properties.

The LL-37 sequence is intrinsically linked to its biological activity. Research shows that LL-37 is an AMP that exhibits a wide range of antimicrobial activity against bacteria, fungi, and even viruses.The scrambled sequence of LL-37. Specifications. Chemistry. Sequence one letter code.GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR. Sequence three letter code. Gly-Leu ... Its mechanism of action often involves disrupting microbial cell membranes, leading to cell death. Beyond its direct antimicrobial effects, however, LL-37 also plays a significant role in modulating the immune responseLL-37, scrambled - 1 mg. It can interact with mammalian cells, influencing inflammation, wound healing, and even angiogenesis.LL-37 | C205H340N60O53 | CID 16198951 - PubChem - NIH Studies have indicated that LL-37 improves sepsis-induced acute lung injury by suppressing pyroptosis in alveolar epithelial cells, highlighting its therapeutic potential in inflammatory conditions. Furthermore, the self-assembly of the antimicrobial human LL-37 active core, particularly the residues 17-29, into protein fibrils demonstrates a complex structural behavior that contributes to its efficacy.

Delving deeper into the variations and structural aspects, researchers have explored different forms and modifications of LL-37. For instance, Ropocamptide is a synthetic form of a human antimicrobial peptide, showcasing a modified version of the natural peptide佛历2551年9月23日—The structure ofLL-37in SDS micelles is composed of a curved amphipathic helix-bend-helix motif spanning residues 2-31 followed by a disordered C-terminal .... Scientific literature also details the LL-37 structure, often elucidated through techniques like X-ray crystallography and NMR spectroscopy. Structures such as the Ll37PDB entries provide detailed three-dimensional insights into how the peptide folds and interacts with its environment. The presence of a curved amphipathic helix-bend-helix motif spanning residues 2-31 followed by a disordered C-terminal region is a common observation in various studies of the LL-37 structure. The ability of LL37 to form dimers of anti-parallel helices, as seen in the 5NNM PDB entry, further underscores its dynamic structural propertiesSequence and the expression construct of SP-LL-37 (A) ....

The complexity of LL-37 extends to its role in various disease states. It has been implicated in conditions like psoriasis, Systemic Lupus Erythematosus (SLE), and Rheumatoid Arthritis (RA), where it can activate inflammatory pathways, particularly when complexed with DNA.LL 37 ; Sequence,[LL-37, 37 aa]; Storage, Store at -20°C ; Purity, ≥95% (HPLC) ; CAS Number, 154947-66-7 ; PubChem ID, 16198951. Conversely, recent findings suggest that the Activation of HIF-1α and LL-37 by commensal bacteria might play a role in modulating host responses, even in contexts like Candida albicans colonization.

For researchers and clinicians seeking to utilize this peptide, various Specifications regarding purity, molecular weight (approximately 4493.37 g), and storage conditions are available作者：E Sancho-Vaello·2020·被引用次数：141—We crystallizedLL-37in the presence of detergents and obtained the structure of a narrow tetrameric channel with a strongly charged core.. Those interested in exploring modified sequences might encounter information on peptides with reversed amino acid sequences, known as retro-analogs, which represent a promising strategy for LL-37 modification.佛历2551年9月23日—The structure ofLL-37in SDS micelles is composed of a curved amphipathic helix-bend-helix motif spanning residues 2-31 followed by a disordered C-terminal ... An example of such a sequence, though not biologically active in the same way as the natural peptide, is the scrambled sequence GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR.

In conclusion, the LL-37 sequence represents a critical component of human host defense with a multifaceted role in both antimicrobial activity and immune regulation. Its precise amino acid composition, distinct structural features, and complex biological interactions continue to be a rich area of research, holding significant promise for future therapeutic interventions. The journey to fully understand this vital peptide is ongoing, with each new discovery adding to our appreciation of its importance in maintaining health and combating disease.